Management von Medizinbetrieben

Management von Medizinbetrieben

H.-Jürgen Seelos

60,39 €
IVA incluido
Disponible
Editorial:
Springer Nature B.V.
Año de edición:
2010
Materia
Economía
ISBN:
9783834923776
60,39 €
IVA incluido
Disponible

Selecciona una librería:

  • Librería Samer Atenea
  • Librería Aciertas (Toledo)
  • Kálamo Books
  • Librería Perelló (Valencia)
  • Librería Elías (Asturias)
  • Donde los libros
  • Librería Kolima (Madrid)
  • Librería Proteo (Málaga)

Artículos relacionados

  • Principles of Economics 2e
    David Shapiro / Steven A. Greenlaw / Steven AGreenlaw / Timothy Taylor
    Principles of Economics 2e covers the scope and sequence of most introductory economics courses. The text includes many current examples, which are handled in a politically equitable way. The outcome is a balanced approach to the theory and application of economics concepts. The second edition has been thoroughly revised to increase clarity, update data and current event impact...
    Disponible

    49,73 €

  • Perspectivas sobre desarrollo y territorio en el nuevo contexto
    José I. Távara / Roxana Barrantes
    Las contribuciones de este volumen intentan expresar el reconocimiento y el homenaje a Efraín Gonzales de Olarte, entrañable integrante de nuestra comunidad universitaria, una persona comprometida con la investigación y la formación de varias generaciones de profesionales y ciudadanos, dedicada al fortalecimiento de la educación en nuestro país, tanto dentro como fuera de las a...
    Disponible

    20,75 €

  • Comparable Worth
    Elaine Sorensen
    For decades women working as nurses, librarians, and secretaries have argued that they are paid less than men in jobs requiring comparable skill and effort. By the late 1980s, the notion of 'comparable worth' had become a familiar one, and comparable worth initiatives were being developed to counteract the persistent disparities between male and female pay. In a comprehensive a...
    Disponible

    47,60 €

  • The Social Life of Money
    Nigel Dodd
    A reevaluation of what money is-and what it might beQuestions about the nature of money have gained a new urgency in the aftermath of the global financial crisis. Even as many people have less of it, there are more forms and systems of money, from local currencies and social lending to mobile money and Bitcoin. Yet our understanding of what money is-and what it might be-hasn’t ...
    Disponible

    36,83 €

  • Advances in Behavioral Economics
    Twenty years ago, behavioral economics did not exist as a field. Most economists were deeply skeptical--even antagonistic--toward the idea of importing insights from psychology into their field. Today, behavioral economics has become virtually mainstream. It is well represented in prominent journals and top economics departments, and behavioral economists, including several con...
    Disponible

    113,11 €

  • Financial Econometrics
    Christian Gouriéroux / Joann Jasiak
    Financial econometrics is a great success story in economics. Econometrics uses data and statistical inference methods, together with structural and descriptive modeling, to address rigorous economic problems. Its development within the world of finance is quite recent and has been paralleled by a fast expansion of financial markets and an increasing variety and complexity of f...
    Disponible

    216,13 €

Otros libros del autor

  • Management von Medizinbetrieben
    H.-Jürgen Seelos
    Mit diesem Buch ermöglicht Hans-Jürgen Seelos die Anwendung der systemorientierten Managementlehre in der institutionalisierten Medizin. Als komplexen, non-trivialen (Dienstleistungs-)Systemen ist Medizinbetrieben a priori ein Management-Paradoxon implizit, das durch Grundkategorien einer systemisch-verhaltenswissenschaftlichen Managementlehre aufgelöst werden kann. Diese defin...
    Disponible

    45,65 €

  • Theorie der Medizinischen Informatik
    H.-Jürgen Seelos
    Diese wissenschaftstheoretische Einführung unterstützt Studierende und Dozenten beim Einstieg in das interdisziplinäre Fachgebiet der Medizinischen Informatik. Die bewußte Abstrahierung von einzelnen methodischen Aspekten ermöglicht dem Leser dabei ein grundlegendes Verständnis dieses Gebietes. Ausgehend vom definierten Wissenschaftsparadigma der Medi...
    Disponible

    85,53 €

  • Personalführung in Medizinbetrieben
    H.-Jürgen Seelos
    ...