Inicio > Economía, finanzas, empresa y gestión > Economía > Ein Wirtschaftssystem der Zukunft
Ein Wirtschaftssystem der Zukunft

Ein Wirtschaftssystem der Zukunft

Ota Sik

85,08 €
IVA incluido
Disponible
Editorial:
Springer Nature B.V.
Año de edición:
1985
Materia
Economía
ISBN:
9783540151371
85,08 €
IVA incluido
Disponible

Selecciona una librería:

  • Librería Samer Atenea
  • Kálamo Books
  • Librería Elías (Asturias)
  • Librería Kolima (Madrid)
  • Librería Proteo (Málaga)

DiesesBuchenthaltdie DarstellungeinesneuenWirtschaftsmodells, das einmal das kapitalistisch-marktwirtschaftliche als auch das kommunistisch-planwirtschaftliche Wirtschaftssystem ersetzen konnte. Die vorliegende Ausgabe stutzt sich dabei auf die Grund­ lagen, die ich bereits in meinem Buch 'Humane Wirtschaftsdemo­ kratie' (Knaus VerlagHamburg, 1979) ausfiihrlichdargestellt habe, sie verzichtet jedoch auf aile mathematischen Formeln und Aus­ drucksweisen. Der Verzicht auf formale Anforderungen macht den TexteinembreitenLeserkreiszuganglich. Es ist mir klar, daB zwischen der Darstellung einestheoretischen Wirtschaftsmodells und seiner eventuellen Realisierung in der Wirt­ schaftspraxisein ungemeinlangerundschwererWegliegt. Abereine jedegroBegesellschaftlicheReformbegannstetsmitIdeen,dielange vordenpraktischenReformbewegungen entstandenwaren. Nurjene gesellschaftlichenIdeenwurden jedoch jeweilszur realenPraxis,die den Erfahrungen und Interessen groBer BevOlkerungsteile, ihren Wunschen und Bestrebungen entsprachen und sie zu politischen Schritteninspirierten. Ob die hier vorgelegten Ideen solchen Interessen entsprechen, kann nur die Zukunft zeigen. In Erwartung einer entsprechenden Interessenentwicklungversucheich,theoretischeMoglichkeiteneiner umfassenden Wirtschaftsreformaufzuzeigen, die unterBeibehaltung der erforderlichen Wirtschaftseffektivitat zur Erweiterung der demokratischen Freiheiten der Volker und zur Humanisierungihres gesellschaftlichen Seinsbeitragenkonnte. St. Gallen, im Februar 1985 OtaSik Inhaltsverzeichnis Einleitung 1 1 BediirfnisseundInteressen . . . . . . . . . . . . . . . . . . . . . . . . 5 1. 1 Bediirfnisgliederung . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 1. 2 Bediirfnisentwicklung imkapitalistischenSystem. . . . . . . 12 1. 3 BediirfnisseundArbeit. . . . . . . . . . . . . . . . . . . . . . . . . . . 18 1. 4 Bedeutungdernichtokonornischen Bediirfnisse . . . . . . . . 23 1. 5 Bedeutung okonomischer Interessen . . . . . . . . . . . . . . . . 27 AnmerkungenzuKapitell 31 2 Notwendigkeit der Wirtschaftsdemokratisierung . . . . . . . 33 2. 1 UberwindungdereinseitigenKonsumtionsentwicklung ' 33 2. 2 GegensatzzwischenLohn- undKapitalinteressen. . . . . . . 40 2. 3 WirtschaftlicheVerantwortungdesVolkes ' 42 2. 4 MitentscheidunginderMikrosphare ' 45 2. 5 Warum Gewinnbildunglmd Gewimiinteressen? . . . . . . . 51 2. 6 Zusammenfassung der Systemreforrnziele ' 55 AnmerkungenzuKapitel2 ,. . . . . . 62 3 MitarbeitergesellschaftenundUnternehmerinitiative. . . . 64 3. 1 Neutralisierungdes Kapitals . . . . . . . . . . . . . . . . . . . . . . . 64 3. 2 Entscheidungsstrukturin Mitarbeitergesellschaften . . . . . 72 3. 3 Einkommensverteilung. . . . . . . . . . . . . . . . . . . . . . . . . . 76 3. 4 Gewinnoptirnierung ,:. 81 3. 5 Entstehung unterschiedlicher Wirtschaftssekto’ren ’. . .

Artículos relacionados

  • Principles of Economics 2e
    David Shapiro / Steven A. Greenlaw / Steven AGreenlaw / Timothy Taylor
    Principles of Economics 2e covers the scope and sequence of most introductory economics courses. The text includes many current examples, which are handled in a politically equitable way. The outcome is a balanced approach to the theory and application of economics concepts. The second edition has been thoroughly revised to increase clarity, update data and current event impact...
    Disponible

    49,73 €

  • Perspectivas sobre desarrollo y territorio en el nuevo contexto
    José I. Távara / Roxana Barrantes
    Las contribuciones de este volumen intentan expresar el reconocimiento y el homenaje a Efraín Gonzales de Olarte, entrañable integrante de nuestra comunidad universitaria, una persona comprometida con la investigación y la formación de varias generaciones de profesionales y ciudadanos, dedicada al fortalecimiento de la educación en nuestro país, tanto dentro como fuera de las a...
    Disponible

    20,75 €

  • Comparable Worth
    Elaine Sorensen
    For decades women working as nurses, librarians, and secretaries have argued that they are paid less than men in jobs requiring comparable skill and effort. By the late 1980s, the notion of 'comparable worth' had become a familiar one, and comparable worth initiatives were being developed to counteract the persistent disparities between male and female pay. In a comprehensive a...
    Disponible

    47,14 €

  • The Social Life of Money
    Nigel Dodd
    A reevaluation of what money is-and what it might beQuestions about the nature of money have gained a new urgency in the aftermath of the global financial crisis. Even as many people have less of it, there are more forms and systems of money, from local currencies and social lending to mobile money and Bitcoin. Yet our understanding of what money is-and what it might be-hasn’t ...
    Disponible

    36,26 €

  • Advances in Behavioral Economics
    Twenty years ago, behavioral economics did not exist as a field. Most economists were deeply skeptical--even antagonistic--toward the idea of importing insights from psychology into their field. Today, behavioral economics has become virtually mainstream. It is well represented in prominent journals and top economics departments, and behavioral economists, including several con...
    Disponible

    111,26 €

  • Financial Econometrics
    Christian Gouriéroux / Joann Jasiak
    Financial econometrics is a great success story in economics. Econometrics uses data and statistical inference methods, together with structural and descriptive modeling, to address rigorous economic problems. Its development within the world of finance is quite recent and has been paralleled by a fast expansion of financial markets and an increasing variety and complexity of f...
    Disponible

    202,91 €

Otros libros del autor

  • Plan and Market Under Socialism
    Ota Sik
    This title was first published in 1967. ...
    Disponible

    91,55 €

  • Czechoslovakia
    Ota Sik
    This title was first published in 1972. ...
    Disponible

    88,61 €

  • Plan and Market Under Socialism
    Ota Sik
    This title was first published in 1967. ...
  • Czechoslovakia
    Ota Sik
    This title was first published in 1972. ...
  • Socialism Today
    Ota Sik
    ...
  • Wirtschaftssysteme
    Ota Sik
    In diesem Buch versuche ich, möglichst leicht verständlich, die bei den heute existierenden Wirtschaftssysteme, das kapitalistisch-marktwirtschaftliche und das sozialistisch-planwirtschaftliche System, in ihren Grundzügen darzustellen und miteinander zu vergleichen. Auch wenn es mir zuerst einmal darum geht, die systembedingte Unterschiedlichkeit der ...
    Disponible

    72,66 €