10990 kaashiiraameishvarayaatradarpand-amu

10990 kaashiiraameishvarayaatradarpand-amu

subramand- subramand-yan’pan’d’itulu

20,02 €
IVA incluido
Disponible
Editorial:
Nabu Press
Año de edición:
2010
ISBN:
9781149211212
20,02 €
IVA incluido
Disponible

Selecciona una librería:

  • Librería Samer Atenea
  • Librería Aciertas (Toledo)
  • Kálamo Books
  • Librería Perelló (Valencia)
  • Librería Elías (Asturias)
  • Donde los libros
  • Librería Kolima (Madrid)
  • Librería Proteo (Málaga)

'10990 kaashiiraameishvarayaatradarpand-amu' is a Telugu travelogue documenting a pilgrimage to Kaashi (Varanasi), a city of immense religious significance in Hinduism. Written by subramand-yan’pan’d’itulu subramand-yan’pan’d’itulu and published in 1917, the book provides a historical snapshot of travel conditions and religious practices of the time. This text offers insights into the experiences of pilgrims, the sacred sites visited, and the cultural context of early 20th-century India. A valuable resource for those interested in Hindu pilgrimage traditions and the history of travel in India.This work has been selected by scholars as being culturally important, and is part of the knowledge base of civilization as we know it. This work was reproduced from the original artifact, and remains as true to the original work as possible. Therefore, you will see the original copyright references, library stamps (as most of these works have been housed in our most important libraries around the world), and other notations in the work.This work is in the public domain in the United States of America, and possibly other nations. Within the United States, you may freely copy and distribute this work, as no entity (individual or corporate) has a copyright on the body of the work.As a reproduction of a historical artifact, this work may contain missing or blurred pages, poor pictures, errant marks, etc. Scholars believe, and we concur, that this work is important enough to be preserved, reproduced, and made generally available to the public. We appreciate your support of the preservation process, and thank you for being an important part of keeping this knowledge alive and relevant.

Artículos relacionados

  • Poetry Is Our Ministry to Touch the Heart
    Anelda Lukesia Ballard / Jean Anelda Scott
    Poetry is Our Ministry to Touch the Heart, was birthed when Anelda L. Ballard became ill. God spoke to her in a dream and said 'pick up a pen and write' by being obedient this book was written through the Holy Spirit. Anelda and her mother Jean A. Scott believes that God’s wants to heal a hurting heart. This book will inspire you and encourage you to never give up hope. Jesu...
    Disponible

    11,12 €

  • I soldati lunghi
    Pierluigi Romeo di Colloredo Mels
    Il 24 maggio 1915 il Regno d’Italia entrò nella Grande Guerra, che si sarebbe dimostrata il momento più alto e tragico della sua storia, a poco più di cinquant’anni dalla sua unificazione.In quella lotta tremenda durata quattro anni, la Brigata Granatieri di Sardegna , con i suoi due valorosi Reggimenti, i più antichi del Regio Esercito scrisse, nel grande quadro della guerra d...
    Disponible

    32,59 €

  • Five Beneath Philly
    Susan Bandy / Tom Richmond
    Allen Williams plans to make something of his life and escape South Philly and the work at Cross Brothers’ Meat Packing Plant. He prepares himself with excellent grades and an upcoming full-ride scholarship to climb out of South Philly forever. Then fate changes his whole world. An only son in a family of six, Allen suddenly finds himself responsible for his mother, grandmother...
    Disponible

    18,28 €

  • Forms
    Sharon Welch
    I am an award-winning artist and my works hang in private residences, community hospitals, businesses, and restaurants across the US and also abroad.  I live in Pierre, South Dakota. Since 2008 I have owned Sharon Welch Gallery and Studio where I paint and teach classes.  My theory is have fun, remove the fear of failure, experiment and let the child inside of you play.Very oft...
  • Ricordi di una ausiliaria
    Andrea Lombardi / Raffaella Duelli
    Le memorie di Raffaella Duelli, Volontaria nel Battaglione Barbarigo della Decima Flottiglia Mas iniziano con la partenza del Barbarigo da Roma, narrando la lunga marcia del reparto verso il nord, sotto il mitragliamento degli aerei Alleati. Quindi, è descritta vividamente l'ultima battaglia del Barbarigo sul Fronte Sud, dal Senio a Comacchio: gli appunti di Raffaella, giov...
    Disponible

    28,08 €

  • Why Didn’t You Ask?
    Panya Dixon
    From an early occurrence in her childhood to a perilous thirteen-year relationship, Panya Dixon too often suffered from various forms of physical, emotional, and sexual abuse. Conflicted between love and the pain her loved ones brought on her, she consistently had to fight for her life and her will to move on. Why Didn’t You Ask? is an expression of Panya’s truth—her trials, pa...
    Disponible

    20,35 €